STC2 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western blot analysis of Lane 1: Negative control (vector only transfected HEK293T lysate) Lane 2: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells) with STC2 polyclonal antibody ( Cat # PAB28313) at 1:100-1:250 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human prostate with STC2 polyclonal antibody ( Cat # PAB28313 ) shows strong cytoplasmic and membranous positivity in glandular cells at 1:500 - 1:1000 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG with STC2 polyclonal antibody ( Cat # PAB28313 ) at 1-4 ug/mL dilution shows positivity in endoplasmic reticulum.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant STC2.
Immunogen
Recombinant protein corresponding to amino acids of recombinant STC2.
Sequence
SAIQKPPTAPPERQPQVDRTKLSRAHHGEAGHHLPEPSSRETGRGAKGERGSKSHPNAHARGRVGGLGAQGPSGSSEWEDEQSEYSDIRR
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:500-1:1000)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Transfected lysate)
Western blot analysis of Lane 1: Negative control (vector only transfected HEK293T lysate) Lane 2: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells) with STC2 polyclonal antibody ( Cat # PAB28313) at 1:100-1:250 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human prostate with STC2 polyclonal antibody ( Cat # PAB28313 ) shows strong cytoplasmic and membranous positivity in glandular cells at 1:500 - 1:1000 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG with STC2 polyclonal antibody ( Cat # PAB28313 ) at 1-4 ug/mL dilution shows positivity in endoplasmic reticulum. -
Gene Info — STC2
Entrez GeneID
8614Protein Accession#
O76061Gene Name
STC2
Gene Alias
STC-2, STCRP
Gene Description
stanniocalcin 2
Omim ID
603665Gene Ontology
HyperlinkGene Summary
This gene encodes a secreted, homodimeric glycoprotein that is expressed in a wide variety of tissues and may have autocrine or paracrine functions. The encoded protein has 10 of its 15 cysteine residues conserved among stanniocalcin family members and is phosphorylated by casein kinase 2 exclusively on its serine residues. Its C-terminus contains a cluster of histidine residues which may interact with metal ions. The protein may play a role in the regulation of renal and intestinal calcium and phosphate transport, cell metabolism, or cellular calcium/phosphate homeostasis. Constitutive overexpression of human stanniocalcin 2 in mice resulted in pre- and postnatal growth restriction, reduced bone and skeletal muscle growth, and organomegaly. Expression of this gene is induced by estrogen and altered in some breast cancers. [provided by RefSeq
Other Designations
STC-related protein|stanniocalcin-related protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com