Product Browser

Last updated: 2016/9/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLC22A8 polyclonal antibody

  • Catalog # : PAB28282
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant SLC22A8.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of recombinant SLC22A8.
  • Sequence:
  • KKEEGERLSLEELKLNLQKEISLAKAKYTASDLFRIPMLR
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:2500-1:5000)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human kidney with SLC22A8 polyclonal antibody ( Cat # PAB28282 ) shows strong cytoplasmic positivity in cells in tubules.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 9376
  • Gene Name:
  • SLC22A8
  • Gene Alias:
  • MGC24086,OAT3
  • Gene Description:
  • solute carrier family 22 (organic anion transporter), member 8
  • Gene Summary:
  • The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. [provided by RefSeq
  • Other Designations:
  • organic anion transporter 3,solute carrier family 22 member 8
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook