Product Browser

Last updated: 2017/1/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RPS25 polyclonal antibody

  • Catalog # : PAB28270
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant RPS25.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of recombinant RPS25.
  • Sequence:
  • VPNYKLITPAVVSERLKIRGSLARAALQELLSKGLIKLVSKHRAQVIYTRNTKGGDAPAAGEDA
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse, Rat
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Western Blot (1:100-1:250)
    Immunofluorescence (1-4 ug/ml)
    Immunohistochemistry (1:50-1:200)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) with RPS25 polyclonal antibody (Cat # PAB28270) at 1:100 - 1:250 dilution.
  • Western Blot
  • Western Blot
  • Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with RPS25 polyclonal antibody (Cat # PAB28270) at 1:100 - 1:250 dilution.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human colon with RPS25 polyclonal antibody (Cat # PAB28270) shows strong cytoplasmic positivity in glandular cells at 1:50-1:200 dilution.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human cell line A-431 with RPS25 polyclonal antibody (Cat # PAB28270) at 1-4 ug/ml shows positivity in cytoplasm.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 6230
  • Gene Name:
  • RPS25
  • Gene Alias:
  • -
  • Gene Description:
  • ribosomal protein S25
  • Gene Summary:
  • Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S25E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq
  • Other Designations:
  • 40S ribosomal protein S25
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook