APOOL polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of cell lysates with APOOL polyclonal antibody ( Cat # PAB27989 ) at 1:100-1:500 dilution.
Lane 1: NIH-3T3
Lane 2: NBT-II
Western Blot
Western blot analysis of Lane 1: RT-4 Lane 2: EFO-21 Lane 3: A-431 Lane 4: Liver Lane 5: Tonsil with APOOL polyclonal antibody ( Cat # PAB27989 ) at 1:250 - 1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human stomach with APOOL polyclonal antibody ( Cat # PAB27989 ) shows strong cytoplasmic positivity in glandular cells at 1:500 - 1:1000 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line A-431 with APOOL polyclonal antibody ( Cat # PAB27989 ) at 1-4 ug/ml dilution shows positivity in mitochondria.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant APOOL.
Immunogen
Recombinant protein corresponding to amino acids of human APOOL
Sequence
ATLGATVCYPVQSVIIAKVTAKKVYATSQQIFGAVKSLWTKSSKEESLPKPKEKTKLGSSSEIEVPAKTTHVLKHSVPLPTELSSEAKTKSESTSGATQFMPDPKLMDHGQSHPED
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:500 - 1:1000)
Western Blot (1:250 - 1:500)
Immunoflurorescence (1-4 µg/ml)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of cell lysates with APOOL polyclonal antibody ( Cat # PAB27989 ) at 1:100-1:500 dilution.
Lane 1: NIH-3T3
Lane 2: NBT-IIWestern Blot
Western blot analysis of Lane 1: RT-4 Lane 2: EFO-21 Lane 3: A-431 Lane 4: Liver Lane 5: Tonsil with APOOL polyclonal antibody ( Cat # PAB27989 ) at 1:250 - 1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human stomach with APOOL polyclonal antibody ( Cat # PAB27989 ) shows strong cytoplasmic positivity in glandular cells at 1:500 - 1:1000 dilution.Immunofluorescence
Immunofluorescent staining of human cell line A-431 with APOOL polyclonal antibody ( Cat # PAB27989 ) at 1-4 ug/ml dilution shows positivity in mitochondria. -
Gene Info — APOOL
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com