Product Browser

Last updated: 2016/9/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLC7A9 polyclonal antibody

  • Catalog # : PAB27931
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant SLC7A9.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human SLC7A9.
  • Sequence:
  • YKFGWAQKISKPITMHLQMLMEVVPPEEDPE
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:1000-1:2500)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human kidney with SLC7A9 polyclonal antibody (Cat # PAB27931) shows strong membranous positivity in renal tubules at 1:1000-1:2500 dilution.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Gene Name:
  • SLC7A9
  • Gene Alias:
  • BAT1,CSNU3,FLJ94301
  • Gene Description:
  • solute carrier family 7 (cationic amino acid transporter, y+ system), member 9
  • Gene Summary:
  • This gene encodes a protein that belongs to a family of light subunits of amino acid transporters. This protein plays a role in the high-affinity and sodium-independent transport of cystine and neutral and dibasic amino acids, and appears to function in the reabsorption of cystine in the kidney tubule. Mutations in this gene cause non-type I cystinuria, a disease that leads to cystine stones in the urinary system due to impaired transport of cystine and dibasic amino acids. Two transcript variants, which encode the same protein, have been found for this gene. [provided by RefSeq
  • Other Designations:
  • B(0,+)-type amino acid transporter 1,bo,+ amino acid transporter,glycoprotein-associated amino acid transporter b0,+AT1,solute carrier family 7, member 9
  • RSS
  • YouTube
  • Linkedin
  • Facebook