NAE1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with NAE1 polyclonal antibody (Cat # PAB27920).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human testis with NAE1 polyclonal antibody (Cat # PAB27920) shows strong nuclear and cytoplasmic positivity in cells of seminiferus ducts.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant NAE1.
Immunogen
Recombinant protein corresponding to amino acids of human NAE1.
Sequence
KPFPELREHFQSYDLDHMEKKDHSHTPWIVIIAKYLAQWYSETNGRIPKTYKEKEDFRDLIRQGILKNENGAPEDEENFEEAIKNVNTALNTTQIPSSIEDIFNDDR
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with NAE1 polyclonal antibody (Cat # PAB27920).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human testis with NAE1 polyclonal antibody (Cat # PAB27920) shows strong nuclear and cytoplasmic positivity in cells of seminiferus ducts. -
Gene Info — NAE1
Entrez GeneID
8883Gene Name
NAE1
Gene Alias
A-116A10.1, APPBP1, HPP1, ula-1
Gene Description
NEDD8 activating enzyme E1 subunit 1
Omim ID
603385Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene binds to the beta-amyloid precursor protein. Beta-amyloid precursor protein is a cell surface protein with signal-transducing properties, and it is thought to play a role in the pathogenesis of Alzheimer's disease. In addition, the encoded protein can form a heterodimer with UBE1C and bind and activate NEDD8, a ubiquitin-like protein. This protein is required for cell cycle progression through the S/M checkpoint. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
NEDD8-activating enzyme E1 subunit|amyloid beta precursor protein binding protein 1, 59kDa|amyloid beta precursor protein-binding protein 1, 59kD|amyloid protein-binding protein 1|protooncogene protein 1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com