OSBPL2 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with OSBPL2 polyclonal antibody (Cat # PAB27896) at 1:100-1:250 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human tonsil with OSBPL2 polyclonal antibody (Cat # PAB27896) shows strong cytoplasmic positivity in reaction center cells at 1:200-1:500 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with OSBPL2 polyclonal antibody (Cat # PAB27896) at 1-4 ug/mL dilution shows positivity in cytoplasm.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant OSBPL2.
Immunogen
Recombinant protein corresponding to amino acids of human OSBPL2.
Sequence
MNGEEEFFDAVTGFDSDNSSGEFSEANQKVTGMIDLDTSKNNRIGKTGERPSQENGIQKHRT
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with OSBPL2 polyclonal antibody (Cat # PAB27896) at 1:100-1:250 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human tonsil with OSBPL2 polyclonal antibody (Cat # PAB27896) shows strong cytoplasmic positivity in reaction center cells at 1:200-1:500 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with OSBPL2 polyclonal antibody (Cat # PAB27896) at 1-4 ug/mL dilution shows positivity in cytoplasm. -
Gene Info — OSBPL2
Entrez GeneID
9885Gene Name
OSBPL2
Gene Alias
FLJ20223, KIAA0772, MGC4307, MGC8342, ORP-2, ORP2
Gene Description
oxysterol binding protein-like 2
Omim ID
606731Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain, although some members contain only the sterol-binding domain. This encoded protein contains only the sterol-binding domain. In vitro studies have shown that the encoded protein can bind strongly to phosphatic acid and weakly to phosphatidylinositol 3-phosphate, but cannot bind to 25-hydroxycholesterol. The protein associates with the Golgi apparatus. Transcript variants encoding different isoforms have been described. [provided by RefSeq
Other Designations
OSBP-related protein 2|OTTHUMP00000031478|OTTHUMP00000031479|oxysterol-binding protein-like 2|oxysterol-binding protein-like protein 2|oxysterol-binding protein-related protein 2
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com