Product Browser

Last updated: 2017/8/13

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GAPDH polyclonal antibody

  • Catalog # : PAB27869
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant GAPDH.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human GAPDH.
  • Sequence:
  • TVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIIS
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:500-1:1000)
    Western Blot (1:100-1:250)
    Immunofluorescence (1-4 ug/mL)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot
  • Western Blot
  • Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with GAPDH polyclonal antibody (Cat # PAB27869) at 1:100-1:250 dilution.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human stomach, lower with GAPDH polyclonal antibody (Cat # PAB27869) shows strong nuclear and cytoplasmic positivity in glandular cells at 1:500-1:1000 dilution.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human cell line U-251 MG with GAPDH polyclonal antibody (Cat # PAB27869) at 1-4 ug/mL dilution shows positivity in plasma membrane & cytoplasm.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 2597
  • Gene Name:
  • GAPDH
  • Gene Alias:
  • G3PD,GAPD,MGC88685
  • Gene Description:
  • glyceraldehyde-3-phosphate dehydrogenase
  • Gene Summary:
  • The product of this gene catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains. Many pseudogenes similar to this locus are present in the human genome. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000174431,OTTHUMP00000174432,aging-associated gene 9 protein,glyceraldehyde 3-phosphate dehydrogenase
  • RSS
  • YouTube
  • Linkedin
  • Facebook