Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NME1-NME2 polyclonal antibody

  • Catalog # : PAB27463
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant NME1-NME2.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human NME1-NME2.
  • Sequence:
  • MVLLSTLGIVFQGEGPPISSCDTGTMANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQ
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:20-1:50)
    Immunofluorescence (1-4 ug/mL)
    Western Blot (1:100-1:250)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western blot analysis of cell lysates with NME1-NME2 polyclonal antibody (Cat # PAB27463) at 1:100-1:500 dilution.
    Lane 1 : NBT-II
    Lane 2 : PC12
  • Western Blot
  • Western Blot
  • Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with NME1-NME2 polyclonal antibody (Cat # PAB27463) at 1:100-1:250 dilution.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human pancreas with NME1-NME2 polyclonal antibody (Cat # PAB27463) shows strong cytoplasmic positivity in exocrine glandular cells at 1:20- 1:50 dilution.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human cell line A-431 with NME1-NME2 polyclonal antibody (Cat # PAB27463) at 1-4 ug/mL dilution shows positivity in cytoplasm.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Gene Name:
  • NME1-NME2
  • Gene Alias:
  • NME2
  • Gene Description:
  • NME1-NME2 readthrough transcript
  • Gene Summary:
  • The NME1-NME2 mRNA is a naturally occurring co-transcribed product of the neighboring NME1 and NME2 genes. The significance of this co-transcribed mRNA and the function of its predicted protein product have not yet been determined. Alternative splicing of this gene results in different transcript variants encoding distinct isoforms, but the full-length nature of each variant has not been defined. [provided by RefSeq
  • Other Designations:
  • NM23-LV,NME1-NME2 protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook