Product Browser

Last updated: 2016/9/25
  • Related Product Showcase
  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ZC3HAV1 polyclonal antibody

  • Catalog # : PAB24543
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant ZC3HAV1.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human ZC3HAV1.
  • Sequence:
  • NGKSGTQDIQPGPLFNNNADGVATDITSTRSLNYKSTSSGHREISSPRIQDAGPASRDVQATGRIADDADPRVALVNDSLSDVTSTTSSRVDDHDSEEICLDHL
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:20-1:50)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot
  • Western Blot
  • Western blot analysis of ZC3HAV1 polyclonal antibody (Cat # PAB24543).
    Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: human plasma, Lane 4: liver, Lane 5: tonsil.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human testis with ZC3HAV1 polyclonal antibody (Cat # PAB24543) shows strong cytoplasmic positivity in cells in seminiferus ducts at 1:20-1:50 dilution.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human cell line U-251 MG shows positivity in plasma membrane, cytoplasm & golgi apparatus.
    Using ZC3HAV1 polyclonal antibody (Cat # PAB24543).
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Gene Name:
  • ZC3HAV1
  • Gene Alias:
  • DKFZp686F2052,DKFZp686H1869,DKFZp686O19171,FLB6421,FLJ13288,MGC48898,ZAP,ZC3H2,ZC3HDC2
  • Gene Description:
  • zinc finger CCCH-type, antiviral 1
  • Gene Summary:
  • This gene encodes a CCCH-type zinc finger protein that is thought to prevent infection by retroviruses. Studies of the rat homolog indicate that the protein may primarily function to inhibit viral gene expression and induce an innate immunity to viral infection. Alternative splicing occurs at this locus and two variants, each encoding distinct isoforms, are described. [provided by RefSeq
  • Other Designations:
  • CCCH-type zinc finger antiviral protein,zinc finger CCCH type, antiviral 1,zinc finger antiviral protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook