ZC3HAV1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western blot analysis of ZC3HAV1 polyclonal antibody (Cat # PAB24543).
Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: human plasma, Lane 4: liver, Lane 5: tonsil.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human testis with ZC3HAV1 polyclonal antibody (Cat # PAB24543) shows strong cytoplasmic positivity in cells in seminiferus ducts at 1:20-1:50 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG shows positivity in plasma membrane, cytoplasm & golgi apparatus.
Using ZC3HAV1 polyclonal antibody (Cat # PAB24543).
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant ZC3HAV1.
Immunogen
Recombinant protein corresponding to amino acids of human ZC3HAV1.
Sequence
NGKSGTQDIQPGPLFNNNADGVATDITSTRSLNYKSTSSGHREISSPRIQDAGPASRDVQATGRIADDADPRVALVNDSLSDVTSTTSSRVDDHDSEEICLDHL
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western blot analysis of ZC3HAV1 polyclonal antibody (Cat # PAB24543).
Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: human plasma, Lane 4: liver, Lane 5: tonsil.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human testis with ZC3HAV1 polyclonal antibody (Cat # PAB24543) shows strong cytoplasmic positivity in cells in seminiferus ducts at 1:20-1:50 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG shows positivity in plasma membrane, cytoplasm & golgi apparatus.
Using ZC3HAV1 polyclonal antibody (Cat # PAB24543). -
Gene Info — ZC3HAV1
Entrez GeneID
56829Protein Accession#
Q7Z2W4Gene Name
ZC3HAV1
Gene Alias
DKFZp686F2052, DKFZp686H1869, DKFZp686O19171, FLB6421, FLJ13288, MGC48898, ZAP, ZC3H2, ZC3HDC2
Gene Description
zinc finger CCCH-type, antiviral 1
Omim ID
607312Gene Ontology
HyperlinkGene Summary
This gene encodes a CCCH-type zinc finger protein that is thought to prevent infection by retroviruses. Studies of the rat homolog indicate that the protein may primarily function to inhibit viral gene expression and induce an innate immunity to viral infection. Alternative splicing occurs at this locus and two variants, each encoding distinct isoforms, are described. [provided by RefSeq
Other Designations
CCCH-type zinc finger antiviral protein|zinc finger CCCH type, antiviral 1|zinc finger antiviral protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com