DDX27 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western blot analysis of DDX27 polyclonal antibody (Cat # PAB24527).
Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: human plasma, Lane 4: liver, Lane 5: tonsil.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human cerebellum with DDX27 polyclonal antibody (Cat # PAB24527) shows strong nucleolar and cytoplasmic positivity in Purkinje cells at 1:10-1:20 dilution.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant DDX27.
Immunogen
Recombinant protein corresponding to amino acids of human DDX27.
Sequence
EDKEAKSGKLEKEKEAKEGSEPKEQEDLQENDEEGSEDEASETDYSSADENILTKADTLKVKDRKKKKKKGQEAGVFFEDASQYDENLSFQ
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western blot analysis of DDX27 polyclonal antibody (Cat # PAB24527).
Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: human plasma, Lane 4: liver, Lane 5: tonsil.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human cerebellum with DDX27 polyclonal antibody (Cat # PAB24527) shows strong nucleolar and cytoplasmic positivity in Purkinje cells at 1:10-1:20 dilution. -
Gene Info — DDX27
Entrez GeneID
55661Protein Accession#
Q96GQ7Gene Name
DDX27
Gene Alias
DKFZp667N057, FLJ12917, FLJ20596, FLJ22238, HSPC259, MGC1018, MGC163147, PP3241, RHLP, Rrp3p, dJ686N3.1
Gene Description
DEAD (Asp-Glu-Ala-Asp) box polypeptide 27
Gene Ontology
HyperlinkGene Summary
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, the function of which has not been determined. [provided by RefSeq
Other Designations
DEAD box polypeptide 27|DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 27|OTTHUMP00000031771|RNA helicase-like protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com