Product Browser

Last updated: 2016/9/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
pathway
antibody promotion
protein promotion

ALDH1A3 polyclonal antibody

  • Catalog # : PAB24490
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant ALDH1A3.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human ALDH1A3.
  • Sequence:
  • ERGGAMATANGAVENGQPDRKPPALPRPIRNLEVKFTKIFIN
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:20-1:50)
    Western Blot (1:250-1:500)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot
  • Western Blot
  • Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with ALDH1A3 polyclonal antibody (Cat # PAB24490) at 1:250-1:500 dilution.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human prostate with ALDH1A3 polyclonal antibody (Cat # PAB24490) shows strong cytoplasmic positivity in glandular cells at 1:20-1:50 dilution.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 220
  • Gene Name:
  • ALDH1A3
  • Gene Alias:
  • ALDH1A6,ALDH6,RALDH3
  • Gene Description:
  • aldehyde dehydrogenase 1 family, member A3
  • Gene Summary:
  • Aldehyde dehydrogenase isozymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. The enzyme encoded by this gene uses retinal as a substrate, either in a free or cellular retinol-binding protein form. [provided by RefSeq
  • Other Designations:
  • acetaldehyde dehydrogenase 6,aldehyde dehydrogenase 1A3,aldehyde dehydrogenase 6,retinaldehyde dehydrogenase 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook