BEST2 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human pancreas with BEST2 polyclonal antibody (Cat # PAB24487) shows strong cytoplasmic positivity in exocrine glandular cells at 1:200-1:500 dilution.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant BEST2.
Immunogen
Recombinant protein corresponding to amino acids of human BEST2.
Sequence
RRLSFLLRKNSCVSEASTGASCSCAVVPEGAAPECSCGDPLLDPGLPEPEAPPPAGPEPLTLIPGPVEPFSIVTMP
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human pancreas with BEST2 polyclonal antibody (Cat # PAB24487) shows strong cytoplasmic positivity in exocrine glandular cells at 1:200-1:500 dilution. -
Gene Info — BEST2
Entrez GeneID
54831Protein Accession#
Q8NFU1Gene Name
BEST2
Gene Alias
FLJ20132, VMD2L1
Gene Description
bestrophin 2
Omim ID
607335Gene Ontology
HyperlinkGene Summary
This gene is a member of the bestrophin gene family of anion channels. Bestrophin genes share a similar gene structure with highly conserved exon-intron boundaries, but with distinct 3' ends. Bestrophins are transmembrane proteins that contain a homologous region rich in aromatic residues, including an invariant arg-phe-pro motif. Mutation in one of the family members (bestrophin 1) is associated with vitelliform macular dystrophy. The bestrophin 2 gene is mainly expressed in the retinal pigment epithelium and colon. [provided by RefSeq
Other Designations
VMD2-like gene 1|vitelliform macular dystrophy 2-like 1
-
Interactome
-
Publication Reference
-
Lineage-Specific Expression of Bestrophin-2 and Bestrophin-4 in Human Intestinal Epithelial Cells.
Ito G, Okamoto R, Murano T, Shimizu H, Fujii S, Nakata T, Mizutani T, Yui S, Akiyama-Morio J, Nemoto Y, Okada E, Araki A, Ohtsuka K, Tsuchiya K, Nakamura T, Watanabe M.
PLoS One 2013 Nov; 8(11):e79693.
Application：IF, Human, Small intestinal, Colon.
-
Lineage-Specific Expression of Bestrophin-2 and Bestrophin-4 in Human Intestinal Epithelial Cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com