ZNF235 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with ZNF235 polyclonal antibody (Cat # PAB24428) at 1:250-1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human rectum with ZNF235 polyclonal antibody (Cat # PAB24428) shows moderate cytoplasmic positivity in glandular cells at 1:50-1:200 dilution.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant ZNF235.
Immunogen
Recombinant protein corresponding to amino acids of human ZNF235.
Sequence
ASVDDNCLVNHIGDHSSIIENQEFPTGKVPNSWSKIYLNETQNYQRSCKQTQMKNKLCIFAPYVDIFSCISHHH
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with ZNF235 polyclonal antibody (Cat # PAB24428) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human rectum with ZNF235 polyclonal antibody (Cat # PAB24428) shows moderate cytoplasmic positivity in glandular cells at 1:50-1:200 dilution. -
Gene Info — ZNF235
Entrez GeneID
9310Protein Accession#
Q14590Gene Name
ZNF235
Gene Alias
ANF270, HZF6, ZFP93, ZNF270
Gene Description
zinc finger protein 235
Omim ID
604749Gene Ontology
HyperlinkGene Summary
This gene product belongs to the zinc finger protein superfamily, members of which are regulatory proteins characterized by nucleic acid-binding zinc finger domains. The encoded protein is a member of the Kruppel family of zinc finger proteins, and contains Kruppel-associated box (KRAB) A and B domains and 15 tandemly arrayed C2H2-type zinc fingers. It is an ortholog of the mouse Zfp93 protein. This gene is located in a cluster of zinc finger genes on 19q13.2. [provided by RefSeq
Other Designations
zinc finger protein 93 homolog|zinc finger protein homologous to Zfp93 in mouse|zinc finger protein homologous to mouse Zfp93
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com