DHX40 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with DHX40 polyclonal antibody (Cat # PAB24320) at 1:250-1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human testis with DHX40 polyclonal antibody (Cat # PAB24320) shows strong nuclear and cytoplasmic positivity in Leydig cells and moderate nuclear staining in subsets of cells in seminiferus ducts at 1:200-1:500 dilution.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant DHX40.
Immunogen
Recombinant protein corresponding to amino acids of human DHX40.
Sequence
SVGRTFCTMDGRGSPVHIHPSSALHEQETKLEWIIFHEVLVTTKVYARIVCPIRYEWVRDLLPKLHEFNAHDLSSVARREVREDARRRWTNKENVKQLKDGISKDVLKKMQRRNDDKSISDARARF
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with DHX40 polyclonal antibody (Cat # PAB24320) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human testis with DHX40 polyclonal antibody (Cat # PAB24320) shows strong nuclear and cytoplasmic positivity in Leydig cells and moderate nuclear staining in subsets of cells in seminiferus ducts at 1:200-1:500 dilution. -
Gene Info — DHX40
Entrez GeneID
79665Protein Accession#
Q8IX18Gene Name
DHX40
Gene Alias
ARG147, DDX40, FLJ22060, FLJ34015, PAD
Gene Description
DEAH (Asp-Glu-Ala-His) box polypeptide 40
Omim ID
607570Gene Ontology
HyperlinkGene Summary
DDX40 is a member of the DExH/D box family of ATP-dependent RNA helicases. RNA helicases catalyze the unwinding of double-stranded RNA and play a role in RNA metabolism, including pre-mRNA splicing, ribosome biogenesis, and organellar gene expression.[supplied by OMIM
Other Designations
DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 40 (RNA helicase)
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com