KCNK17 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western blot analysis of Lane 1: Negative control (vector only transfected HEK293T lysate).
Lane 2: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells with KCNK17 polyclonal antibody (Cat # PAB24275).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human testis with KCNK17 polyclonal antibody (Cat # PAB24275) shows strong nuclear positivity in cells in seminiferus ducts.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant KCNK17.
Immunogen
Recombinant protein corresponding to amino acids of human KCNK17.
Sequence
CSCCHHSSKEDFKSQSWRQGPDREPESHSPQQGCYPEGPMGIIQHLEPSAHAAGCGKDS
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Transfected lysate)
Western blot analysis of Lane 1: Negative control (vector only transfected HEK293T lysate).
Lane 2: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells with KCNK17 polyclonal antibody (Cat # PAB24275).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human testis with KCNK17 polyclonal antibody (Cat # PAB24275) shows strong nuclear positivity in cells in seminiferus ducts. -
Gene Info — KCNK17
Entrez GeneID
89822Protein Accession#
Q96T54Gene Name
KCNK17
Gene Alias
K2p17.1, TALK-2, TALK2, TASK-4, TASK4
Gene Description
potassium channel, subfamily K, member 17
Omim ID
607370Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the family of potassium channel proteins containing two pore-forming P domains. This channel is an open rectifier which primarily passes outward current under physiological K+ concentrations. This gene is activated at alkaline pH. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
2P domain potassium channel Talk-2|OTTHUMP00000016346|TWIK-related acid-sensitive K(+) channel 4|TWIK-related alkaline pH-activated K(+) channel 2
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com