KATNB1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western blot analysis of Lane 1: Negative control (vector only transfected HEK293T lysate).
Lane 2: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells with KATNB1 polyclonal antibody (Cat # PAB23861).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human lateral ventricle with KATNB1 polyclonal antibody (Cat # PAB23861) shows strong cytoplasmic positivity in neuronal cells.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant KATNB1.
Immunogen
Recombinant protein corresponding to amino acids of human KATNB1.
Sequence
FHPNEYLLASGSSDRTIRFWDLEKFQVVSCIEGEPGPVRSVLFNPDGCCLYSGCQDSLRVYGWEPERCFDVVLVNWGKVADLAICNDQLIGVAFSQSNVSSY
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Transfected lysate)
Western blot analysis of Lane 1: Negative control (vector only transfected HEK293T lysate).
Lane 2: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells with KATNB1 polyclonal antibody (Cat # PAB23861).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human lateral ventricle with KATNB1 polyclonal antibody (Cat # PAB23861) shows strong cytoplasmic positivity in neuronal cells. -
Gene Info — KATNB1
Entrez GeneID
10300Protein Accession#
Q9BVA0Gene Name
KATNB1
Gene Alias
KAT
Gene Description
katanin p80 (WD repeat containing) subunit B 1
Omim ID
602703Gene Ontology
HyperlinkGene Summary
Microtubules, polymers of alpha and beta tubulin subunits, form the mitotic spindle of a dividing cell and help to organize membranous organelles during interphase. Katanin is a heterodimer that consists of a 60 kDa ATPase (p60 subunit A 1) and an 80 kDa accessory protein (p80 subunit B 1). The p60 subunit acts to sever and disassemble microtubules, while the p80 subunit targets the enzyme to the centrosome. Katanin is a member of the AAA family of ATPases. [provided by RefSeq
Other Designations
katanin (80 kDa)|katanin p80 (WD40-containing) subunit B 1|katanin p80 subunit B 1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com