CORO2A polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with CORO2A polyclonal antibody (Cat # PAB23759).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human stomach with CORO2A polyclonal antibody (Cat # PAB23759) shows strong cytoplasmic and membranous positivity in glandular cells.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant CORO2A.
Immunogen
Recombinant protein corresponding to amino acids of human CORO2A.
Sequence
DIYPPTAGAQPSLTAQEWLSGMNRDPILVSLRPGSELLRPHPLPAERPIFNSMAPASPRLLNQTEKLAAEDGW
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with CORO2A polyclonal antibody (Cat # PAB23759).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human stomach with CORO2A polyclonal antibody (Cat # PAB23759) shows strong cytoplasmic and membranous positivity in glandular cells. -
Gene Info — CORO2A
Entrez GeneID
7464Protein Accession#
Q92828Gene Name
CORO2A
Gene Alias
CLIPINB, DKFZp686G19226, IR10, WDR2
Gene Description
coronin, actin binding protein, 2A
Omim ID
602159Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 5 WD repeats, and has a structural similarity with actin-binding proteins: the D. discoideum coronin and the human p57 protein, suggesting that this protein may also be an actin-binding protein that regulates cell motility. Alternative splicing of this gene generates 2 transcript variants. [provided by RefSeq
Other Designations
OTTHUMP00000021767|OTTHUMP00000021768|WD protein IR10|WD repeat-containing protein 2|WD-repeat protein 2|coronin 2A|coronin, actin-binding protein, 2A|coronin-2A|coronin-like protein B
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com