RMI2 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with RMI2 polyclonal antibody (Cat # PAB23731) at 1:250-1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human stomach with RMI2 polyclonal antibody (Cat # PAB23731) shows strong cytoplasmic positivity in glandular cells at 1:200-1:500 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG with RMI2 polyclonal antibody (Cat # PAB23731) at 1-4 ug/mL dilution shows positivity in nucleus and cytoplasm.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant RMI2.
Immunogen
Recombinant protein corresponding to amino acids of human RMI2.
Sequence
GKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNI
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with RMI2 polyclonal antibody (Cat # PAB23731) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human stomach with RMI2 polyclonal antibody (Cat # PAB23731) shows strong cytoplasmic positivity in glandular cells at 1:200-1:500 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG with RMI2 polyclonal antibody (Cat # PAB23731) at 1-4 ug/mL dilution shows positivity in nucleus and cytoplasm. -
Gene Info — RMI2
Entrez GeneID
116028Protein Accession#
Q96E14Gene Name
RMI2
Gene Alias
BLAP18, C16orf75
Gene Description
RMI2, RecQ mediated genome instability 2, homolog (S. cerevisiae)
Gene Ontology
HyperlinkGene Summary
RMI2 is a component of the BLM (RECQL3; MIM 604610) complex, which plays a role in homologous recombination-dependent DNA repair and is essential for genome stability (Xu et al., 2008 [PubMed 18923082]).[supplied by OMIM
Other Designations
BLM-associated protein of 18 kDa; RecQ-mediated genome instability 2, S. cerevisiae, homolog of; hRMI2; recQ-mediated genome instability protein 2
-
Interactome
-
Disease
-
Publication Reference
-
A combined bioinformatics and experimental approach identifies RMI2 as a Wnt/β-catenin signaling target gene related to hepatocellular carcinoma.
Hung‑Wen Tsai, Shu‑Wen Cheng, Chou‑Cheng Chen, I‑Wen Chen and Chung‑Liang Ho.
BMC Cancer 2023 Oct; 23(1):1025.
Application：WB, IHC, Co-IP, Human, HCC cells, Liver parenchyma tissue, cell lysates .
-
A combined bioinformatics and experimental approach identifies RMI2 as a Wnt/β-catenin signaling target gene related to hepatocellular carcinoma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com