SEC24C polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with SEC24C polyclonal antibody (Cat # PAB23633) at 1:250-1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human stomach with SEC24C polyclonal antibody (Cat # PAB23633) shows moderate granular cytoplasmic positivity in glandular cells at 1:500-1:1000 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG with SEC24C polyclonal antibody (Cat # PAB23633) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli and vesicles.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant SEC24C.
Immunogen
Recombinant protein corresponding to amino acids of human SEC24C.
Sequence
RLPSMTGPLLPGQSFGGPSVSQPNHVSSPPQALPPGTQMTGPLGPLPPMHSPQQPGYQPQQNGSFGPARGPQSNYGGPYPAAPTF
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with SEC24C polyclonal antibody (Cat # PAB23633) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human stomach with SEC24C polyclonal antibody (Cat # PAB23633) shows moderate granular cytoplasmic positivity in glandular cells at 1:500-1:1000 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG with SEC24C polyclonal antibody (Cat # PAB23633) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli and vesicles. -
Gene Info — SEC24C
Entrez GeneID
9632Protein Accession#
P53992Gene Name
SEC24C
Gene Alias
KIAA0079
Gene Description
SEC24 family, member C (S. cerevisiae)
Omim ID
607185Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the SEC24 subfamily of the SEC23/SEC24 family, which is involved in vesicle trafficking. The encoded protein has similarity to yeast Sec24p component of COPII. COPII is the coat protein complex responsible for vesicle budding from the ER. The product of this gene may play a role in shaping the vesicle, as well as in cargo selection and concentration. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq
Other Designations
OTTHUMP00000019829|OTTHUMP00000019830|SEC24 related gene family, member C|SEC24-related protein C|protein transport protein SEC24C
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com