SPAG9 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human testis with SPAG9 polyclonal antibody (Cat # PAB23483) shows strong cytoplasmic positivity in cells of seminiferus ducts.
Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG with SPAG9 polyclonal antibody (Cat # PAB23483) at 1-4 ug/mL dilution shows positivity in cytoplasm.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant SPAG9.
Immunogen
Recombinant protein corresponding to amino acids of human SPAG9.
Sequence
SGQVDKASLCGSMTSNSSAETDSLLGGITVVGCSAEGVTGAATSPSTNGASPVMDKPPEMEAENSEVDENVPTAEEATEATEGNAGSAEDTVDISQTGVYTEHVFTDPLGVQIPEDLSPVYQSSN
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human testis with SPAG9 polyclonal antibody (Cat # PAB23483) shows strong cytoplasmic positivity in cells of seminiferus ducts.Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG with SPAG9 polyclonal antibody (Cat # PAB23483) at 1-4 ug/mL dilution shows positivity in cytoplasm. -
Gene Info — SPAG9
Entrez GeneID
9043Protein Accession#
O60271Gene Name
SPAG9
Gene Alias
FLJ13450, FLJ14006, FLJ26141, FLJ34602, HLC4, JLP, KIAA0516, MGC117291, MGC14967, MGC74461, PHET, PIG6
Gene Description
sperm associated antigen 9
Omim ID
605430Gene Ontology
HyperlinkGene Summary
Extracellular signals are transduced into cells through mitogen-activated protein kinases. The structural organization of these kinases into specific signaling domains is facilitated by scaffolding proteins involved in closely tethering different kinases so that successive phosphorylation events can occur. The protein encoded by this gene is a scaffolding protein that brings together mitogen-activated protein kinases and their transcription factor targets for the activation of specific signaling pathways. This gene which is abundantly expressed in testicular haploid germ cells encodes a protein that is recognized by sperm-agglutinating antibodies and implicated in infertility. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
HLC-4 protein|JNK interacting protein|JNK-associated leucine-zipper protein|JNK/SAPK-associated protein|Max-binding protein|c-Jun NH2-terminal kinase-associated leucine zipper protein|lung cancer oncogene 4|proliferation-inducing gene 6|sperm specific pro
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com