PEX5 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant PEX5.
Immunogen
Recombinant protein corresponding to amino acids of human PEX5.
Sequence
DAVDVTQDYNETDWSQEFISEVTDPLSVSPARWAEEYLEQSEEKLWLGEPEGTATDRWYDEYHPEEDLQHTASDFVAKVDDPKLA
Host
Rabbit
Reactivity
Human, Mouse
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with PEX5 polyclonal antibody (Cat # PAB23410) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human kidney with PEX5 polyclonal antibody (Cat # PAB23410) shows strong cytoplasmic positivity in cells of tubules at 1:50-1:200 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with PEX5 polyclonal antibody (Cat # PAB23410) at 1-4 ug/mL dilution shows positivity in cytoplasm. -
Gene Info — PEX5
Entrez GeneID
5830Protein Accession#
P50542Gene Name
PEX5
Gene Alias
FLJ50634, FLJ50721, FLJ51948, PTS1-BP, PTS1R, PXR1
Gene Description
peroxisomal biogenesis factor 5
Gene Ontology
HyperlinkGene Summary
The product of this gene binds to the C-terminal PTS1-type tripeptide peroxisomal targeting signal (SKL-type) and plays an essential role in peroxisomal protein import. Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function. The peroxisomal biogenesis disorders are a heterogeneous group with at least 14 complementation groups and with more than 1 phenotype being observed in cases falling into particular complementation groups. Although the clinical features of PBD patients vary, cells from all PBD patients exhibit a defect in the import of one or more classes of peroxisomal matrix proteins into the organelle. Defects in this gene are a cause of neonatal adrenoleukodystrophy (NALD), a cause of Zellweger syndrome (ZWS) as well as may be a cause of infantile Refsum disease (IRD). Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
peroxin-5|peroxisomal C-terminal targeting signal import receptor|peroxisomal targeting signal 1 (SKL type) receptor|peroxisomal targeting signal import receptor|peroxisomal targeting signal receptor 1|peroxisome receptor 1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com