Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ATP4A polyclonal antibody

  • Catalog # : PAB23402
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant ATP4A.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human ATP4A.
  • Sequence:
  • TDYFTAMAQEGWFPLLCVGLRAQWEDHHLQDLQDSYGQ
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:20-1:50)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human stomach with ATP4A polyclonal antibody (Cat # PAB23402) shows strong cytoplasmic positivity in parietal cells at 1:20-1:50 dilution.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 495
  • Gene Name:
  • ATP4A
  • Gene Alias:
  • ATP6A
  • Gene Description:
  • ATPase, H+/K+ exchanging, alpha polypeptide
  • Gene Summary:
  • The protein encoded by this gene belongs to a family of P-type cation-transporting ATPases. The gastric H+, K+-ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for gastric acid secretion. This gene encodes a catalytic alpha subunit of the gastric H+, K+-ATPase. [provided by RefSeq
  • Other Designations:
  • ATPase, H+/K+ transporting, alpha polypeptide,OTTHUMP00000045780,gastric H+/K+ ATPase alpha subunit,gastric H,K-ATPase catalytic subunit,gastric hydrogen-potassium ATPase,hydrogen/potassium-exchanging ATPase 4A,potassium-transporting ATPase alpha chain 1,
  • RSS
  • YouTube
  • Linkedin
  • Facebook