SLC39A8 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with SLC39A8 polyclonal antibody (Cat # PAB23353).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human salivary gland with SLC39A8 polyclonal antibody (Cat # PAB23353) shows moderate luminal membranous positivity in glandular cells.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant SLC39A8.
Immunogen
Recombinant protein corresponding to amino acids of human SLC39A8.
Sequence
ANLSLSAAQLQHLLEQMGAASRVGVPEPGQLHFNQCLTAEEIFSLHGFSNATQITSSKFSVICPAVLQQLNFHPCEDRPKHKTRPSHS
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with SLC39A8 polyclonal antibody (Cat # PAB23353).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human salivary gland with SLC39A8 polyclonal antibody (Cat # PAB23353) shows moderate luminal membranous positivity in glandular cells. -
Gene Info — SLC39A8
Entrez GeneID
64116Protein Accession#
Q9C0K1Gene Name
SLC39A8
Gene Alias
BIGM103, LZT-Hs6, PP3105, ZIP8
Gene Description
solute carrier family 39 (zinc transporter), member 8
Omim ID
608732Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the SLC39 family of solute-carrier genes, which show structural characteristics of zinc transporters. The encoded protein is glycosylated and found in the plasma membrane and mitochondria, and functions in the cellular import of zinc at the onset of inflammation. It is also thought to be the primary transporter of the toxic cation cadmium, which is found in cigarette smoke. Multiple transcript variants encoding different isoforms have been found for this gene. Additional alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. [provided by RefSeq
Other Designations
BCG induced integral membrane protein BIGM103|LIV-1 subfamily of ZIP zinc transporter 6|Zrt- and Irt-like protein 8|solute carrier family 39 (metal ion transporter), member 8|zinc transporter ZIP8
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com