Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PNISR polyclonal antibody

  • Catalog # : PAB23350
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant PNISR.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human PNISR.
  • Sequence:
  • PLNQQQWMQSFQHQQDPSQIDWAALAQAWIAQREASGQQSMVEQPPGMMPNGQDMSTMESGPNNHGNFQGDSNFNRMWQPEWGMHQQPPHPPPDQPWMPPTPGPMDIVPPSEDSNSQDSGEFAPDNRHIFNQNNHNFGG
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (1-4 ?g/ml)
    Immunohistochemistry (1:50-1:200)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human kidney with PNISR polyclonal antibody (Cat # PAB23350) shows moderate cytoplasmic positivity in cells in tubules.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of HeLa cells shows positivity in cytoplasm and nucleus but excluded from the nucleoli with PNISR polyclonal antibody (Cat # PAB23350) under 1-4 ug/mL working concentration.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Gene Name:
  • PNISR
  • Gene Alias:
  • HSPC261,C6orf111,HSPC306,RP11-98I9.2,SFRS18,SRrp130,bA98I9.2
  • Gene Description:
  • PNN-interacting serine/arginine-rich protein
  • Other Designations:
  • SR rich protein; SR-related protein; SR-rich protein; arginine/serine-rich protein PNISR; serine-arginine-rich-splicing regulatory protein 130; serine/arginine-rich-splicing regulatory protein 130; splicing factor, arginine/serine-rich 130; splicing facto
  • RSS
  • YouTube
  • Linkedin
  • Facebook