PPRC1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with PPRC1 polyclonal antibody (Cat # PAB23299) at 1:250-1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human duodenum with PPRC1 polyclonal antibody (Cat # PAB23299) shows moderate cytoplasmic positivity in glandular cells at 1:500-1:1000 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line A-431 with PPRC1 polyclonal antibody (Cat # PAB23299) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant PPRC1.
Immunogen
Recombinant protein corresponding to amino acids of human PPRC1.
Sequence
ASPHPKHKVSALVQSPQMKALACVSAEGVTVEEPASERLKPETQETRPREKPPLPATKAVPTPRQSTVPKLPAVHPARLRKLSFLPTPRTQGSEDVVQ
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with PPRC1 polyclonal antibody (Cat # PAB23299) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human duodenum with PPRC1 polyclonal antibody (Cat # PAB23299) shows moderate cytoplasmic positivity in glandular cells at 1:500-1:1000 dilution.Immunofluorescence
Immunofluorescent staining of human cell line A-431 with PPRC1 polyclonal antibody (Cat # PAB23299) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli. -
Gene Info — PPRC1
Entrez GeneID
23082Protein Accession#
Q5VV67Gene Name
PPRC1
Gene Alias
KIAA0595, MGC74642, PRC, RP11-302K17.6
Gene Description
peroxisome proliferator-activated receptor gamma, coactivator-related 1
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is similar to PPAR-gamma coactivator 1 (PPARGC1/PGC-1), a protein that can activate mitochondrial biogenesis in part through a direct interaction with nuclear respiratory factor 1 (NRF1). This protein has been shown to interact with NRF1. It is thought to be a functional relative of PPARGC1 that activates mitochondrial biogenesis through NRF1 in response to proliferative signals. [provided by RefSeq
Other Designations
OTTHUMP00000020358|PGC-1 related co-activator|peroxisome proliferative activated receptor, gamma, coactivator-related 1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com