COPS4 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with COPS4 polyclonal antibody (Cat # PAB23079) at 1:250-1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human cerebellum with COPS4 polyclonal antibody (Cat # PAB23079) shows strong nuclear and cytoplasmic positivity in Purkinje cells at 1:20-1:50 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG with COPS4 polyclonal antibody (Cat # PAB23079) at 1-4 ug/mL dilution shows positivity in nucleus.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant COPS4.
Immunogen
Recombinant protein corresponding to amino acids of human COPS4.
Sequence
ALKHALHCTILASAGQQRSRMLATLFKDERCQQLAAYGILEKMYLDRIIRGNQLQEFAAMLMPHQKATTADGSSILDRAVIEHNLLSASKLY
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with COPS4 polyclonal antibody (Cat # PAB23079) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human cerebellum with COPS4 polyclonal antibody (Cat # PAB23079) shows strong nuclear and cytoplasmic positivity in Purkinje cells at 1:20-1:50 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG with COPS4 polyclonal antibody (Cat # PAB23079) at 1-4 ug/mL dilution shows positivity in nucleus. -
Gene Info — COPS4
Entrez GeneID
51138Protein Accession#
Q9BT78Gene Name
COPS4
Gene Alias
CSN4, MGC10899, MGC15160
Gene Description
COP9 constitutive photomorphogenic homolog subunit 4 (Arabidopsis)
Gene Ontology
HyperlinkGene Summary
This gene encodes one of eight subunits composing COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. [provided by RefSeq
Other Designations
COP9 signalosome subunit 4
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com