Product Browser

Last updated: 2016/9/25
  • Related Product Showcase
  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

STT3B polyclonal antibody

  • Catalog # : PAB23044
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant STT3B.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human STT3B.
  • Sequence:
  • NPPVEDSSDEDDKRNQGNLYDKAGKVRKHATEQEKTEEGLGP
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:500-1:1000)
    Immunofluorescence (1-4 ug/mL)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human testis with STT3B polyclonal antibody (Cat # PAB23044) shows strong cytoplasmic positivity in spermatogonia.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human cell line A-431 with STT3B polyclonal antibody (Cat # PAB23044) at 1-4 ug/mL dilution shows positivity in endoplasmic reticulum.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Gene Name:
  • STT3B
  • Gene Alias:
  • FLJ90106,SIMP,STT3-B
  • Gene Description:
  • STT3, subunit of the oligosaccharyltransferase complex, homolog B (S. cerevisiae)
  • Gene Summary:
  • The SIMP protein contains a highly immunogenic minor histocompatibility antigen epitope of 9 amino acids, B6(dom1). Like ITM1 (MIM 601134), SIMP is homologous to yeast STT3, an oligosaccharyltransferase essential for cell proliferation (McBride et al., 2002 [PubMed 12439619]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000161258,homolog of yeast STT3,source of immunodominant MHC associated peptides,source of immunodominant MHC-associated peptides
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook