HNRNPA0 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with HNRNPA0 polyclonal antibody (Cat # PAB23029) at 1:250-1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human stomach with HNRNPA0 polyclonal antibody (Cat # PAB23029) shows strong nuclear positivity in glandular cells at 1:1000-1:2500 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line A-431 with HNRNPA0 polyclonal antibody (Cat # PAB23029) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant HNRNPA0.
Immunogen
Recombinant protein corresponding to amino acids of human HNRNPA0.
Sequence
RGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKAVPKEDIYSGG
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:1000-1:2500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with HNRNPA0 polyclonal antibody (Cat # PAB23029) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human stomach with HNRNPA0 polyclonal antibody (Cat # PAB23029) shows strong nuclear positivity in glandular cells at 1:1000-1:2500 dilution.Immunofluorescence
Immunofluorescent staining of human cell line A-431 with HNRNPA0 polyclonal antibody (Cat # PAB23029) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli. -
Gene Info — HNRNPA0
Entrez GeneID
10949Protein Accession#
Q13151Gene Name
HNRNPA0
Gene Alias
HNRPA0
Gene Description
heterogeneous nuclear ribonucleoprotein A0
Omim ID
609409Gene Ontology
HyperlinkGene Summary
This gene belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind RNAs, followed by a glycine-rich C-terminus. [provided by RefSeq
Other Designations
OTTHUMP00000159432|hnRNA binding protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com