LRPPRC polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with LRPPRC polyclonal antibody (Cat # PAB22998) at 1:250-1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human cerebellum with LRPPRC polyclonal antibody (Cat # PAB22998) shows strong granular cytoplasmic positivity in purkinje cells at 1:10-1:20 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with LRPPRC polyclonal antibody (Cat # PAB22998) at 1-4 ug/mL dilution shows positivity in mitochondria.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant LRPPRC.
Immunogen
Recombinant protein corresponding to amino acids of human LRPPRC.
Sequence
RIWDTLQKLGAVYDVSHYNALLKVYLQNEYKFSPTDFLAKMEEANIQPNRVTYQRLIASYCNVGDIEGASKILGFMKTKDLPVT
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with LRPPRC polyclonal antibody (Cat # PAB22998) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human cerebellum with LRPPRC polyclonal antibody (Cat # PAB22998) shows strong granular cytoplasmic positivity in purkinje cells at 1:10-1:20 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with LRPPRC polyclonal antibody (Cat # PAB22998) at 1-4 ug/mL dilution shows positivity in mitochondria. -
Gene Info — LRPPRC
Entrez GeneID
10128Protein Accession#
P42704Gene Name
LRPPRC
Gene Alias
CLONE-23970, GP130, LRP130, LSFC
Gene Description
leucine-rich PPR-motif containing
Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that is leucine-rich and is thought to play a role in regulating the interaction of the cytoskeleton with a variety of cellular processes. Mutations in this gene are associated with the French-Canadian type of Leigh syndrome. Transcripts ranging in size from 4.8 to 7.0 kb which result from alternative polyadenylation have been reported for this gene. [provided by RefSeq
Other Designations
leucine-rich PPR motif-containing protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com