PPP2R3A polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with PPP2R3A polyclonal antibody (Cat # PAB22913) at 1:250-1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human hippocampus with PPP2R3A polyclonal antibody (Cat # PAB22913) shows moderate cytoplasmic positivity in neuronal cells at 1:200-1:500 dilution.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant PPP2R3A.
Immunogen
Recombinant protein corresponding to amino acids of human PPP2R3A.
Sequence
EQRDPFAVQKDVENDGPEPSDWDRFAAEEYETLVAEESAQAQFQEGFEDYETDEPASPSEFGNKSNKILSASLPEKCGKLQSVDEE
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with PPP2R3A polyclonal antibody (Cat # PAB22913) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human hippocampus with PPP2R3A polyclonal antibody (Cat # PAB22913) shows moderate cytoplasmic positivity in neuronal cells at 1:200-1:500 dilution. -
Gene Info — PPP2R3A
Entrez GeneID
5523Protein Accession#
Q06190Gene Name
PPP2R3A
Gene Alias
PPP2R3, PR130, PR72
Gene Description
protein phosphatase 2 (formerly 2A), regulatory subunit B'', alpha
Omim ID
604944Gene Ontology
HyperlinkGene Summary
Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2 holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B'/PR61, and B''/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. The product of this gene belongs to the B'' family. The B'' family has been further divided into subfamilies. The product of this gene belongs to the alpha subfamily of regulatory subunit B''. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
PP2A, subunit B, B''-PR72/PR130|PP2A, subunit B, B72/B130 isoforms|PP2A, subunit B, R3 isoform|Serine/threonine protein phosphatase 2A, 72/130 kDa regulatory subunit B|protein phosphatase 2 (formerly 2A), regulatory subunit B'' (PR 72), alpha isoform and
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com