Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

UNC93A polyclonal antibody

  • Catalog # : PAB22900
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant UNC93A.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human UNC93A.
  • Sequence:
  • QPIRDVQRESEGEKKSVPFWSTLLSTFKLYRDKR
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:20-1:50)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human small intestine with UNC93A polyclonal antibody (Cat # PAB22900) shows strong cytoplasmic and membranous positivity in glandular cells at 1:20-1:50 dilution.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Gene Name:
  • UNC93A
  • Gene Alias:
  • MGC119395,MGC119397,dJ366N23.1,dJ366N23.2
  • Gene Description:
  • unc-93 homolog A (C. elegans)
  • Other Designations:
  • dJ366N23.1 (putative C. elegans UNC-93 (protein 1, C46F11.1) LIKE),dJ366N23.2 (putative C. elegans UNC-93 (protein 1, C46F11.1) C-terminal LIKE),unc-93 homolog A,unc93 homolog A
  • RSS
  • YouTube
  • Linkedin
  • Facebook