HS6ST2 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with HS6ST2 polyclonal antibody (Cat # PAB22628) at 1:250-1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human cerebral cortex with HS6ST2 polyclonal antibody (Cat # PAB22628) shows strong cytoplasmic positivity in neuronal cells at 1:50-1:200 dilution.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant HS6ST2.
Immunogen
Recombinant protein corresponding to amino acids of human HS6ST2.
Sequence
RKRQEQRKFLKGRLLQTHFQSQGQGQSQNPNQNQSQNPNPNANQNLTQNLMQNLTQSLSQKENRESPKQNSGKEQNDNTSNGTND
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with HS6ST2 polyclonal antibody (Cat # PAB22628) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human cerebral cortex with HS6ST2 polyclonal antibody (Cat # PAB22628) shows strong cytoplasmic positivity in neuronal cells at 1:50-1:200 dilution. -
Gene Info — HS6ST2
Entrez GeneID
90161Protein Accession#
Q96MM7Gene Name
HS6ST2
Gene Alias
MGC130022, MGC130023
Gene Description
heparan sulfate 6-O-sulfotransferase 2
Omim ID
300545Gene Ontology
HyperlinkGene Summary
Heparan sulfate proteoglycans are ubiquitous components of the cell surface, extracellular matrix, and basement membranes, and interact with various ligands to influence cell growth, differentiation, adhesion, and migration. This gene encodes a member of the heparan sulfate (HS) sulfotransferase gene family, which catalyze the transfer of sulfate to HS. Different family members and isoforms are thought to synthesize heparan sulfates with tissue-specific structures and functions. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
-
-
Interactome
-
Pathway
-
Publication Reference
-
Upregulation of Heparan Sulfate 6-O-Sulfation in Idiopathic Pulmonary Fibrosis.
Lu J, Auduong L, White ES, Yue X.
American Journal of Respiratory Cell and Molecular Biology 2014 Jan; 50(1):106.
Application：IHC, Human, Human lung tissues.
-
Upregulation of Heparan Sulfate 6-O-Sulfation in Idiopathic Pulmonary Fibrosis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com