EXOC2 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with EXOC2 polyclonal antibody (Cat # PAB22609) at 1:250-1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human pancreas with EXOC2 polyclonal antibody (Cat # PAB22609) shows strong cytoplasmic and membranous positivity in intercalated ducts at 1:2500-1:5000 dilution.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant EXOC2.
Immunogen
Recombinant protein corresponding to amino acids of human EXOC2.
Sequence
IIVTTKSGGRGTSTVSFKLLKPEKIGILDQSAVWVDEMNYYDMRTDRNKGIPPLSLRPANPLGIEIEKSKFSQKDLEMLFHGMSADFTS
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:2500-1:5000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with EXOC2 polyclonal antibody (Cat # PAB22609) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human pancreas with EXOC2 polyclonal antibody (Cat # PAB22609) shows strong cytoplasmic and membranous positivity in intercalated ducts at 1:2500-1:5000 dilution. -
Gene Info — EXOC2
Entrez GeneID
55770Protein Accession#
Q96KP1Gene Name
EXOC2
Gene Alias
FLJ11026, SEC5, SEC5L1, Sec5p
Gene Description
exocyst complex component 2
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and the functions of the exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. This interaction has been shown to mediate filopodia formation in fibroblasts. [provided by RefSeq
Other Designations
OTTHUMP00000039160|SEC5-like 1|Sec5 protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com