Product Browser

Last updated: 2016/9/25
  • Related Product Showcase
  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

WRNIP1 polyclonal antibody

  • Catalog # : PAB22586
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant WRNIP1.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human WRNIP1.
  • Sequence:
  • YQGCHFIGMPECEVLLAQCVVYFARAPKSIEVYSAYNNVKARLRNHQGPLPPVPLHLRNAPTRLMKDLGYG
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:10-1:20)
    Western Blot (1:250-1:500)
    Immunofluorescence (1-4 ug/mL)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot
  • Western Blot
  • Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with WRNIP1 polyclonal antibody (Cat # PAB22586) at 1:250-1:500 dilution.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human testis with WRNIP1 polyclonal antibody (Cat # PAB22586) shows strong nuclear positivity in cells of seminiferus ducts at 1:10-1:20 dilution.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human cell line U-251MG with WRNIP1 polyclonal antibody (Cat # PAB22586) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli and mitochondria.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Gene Name:
  • WRNIP1
  • Gene Alias:
  • FLJ22526,RP11-420G6.2,WHIP,bA420G6.2
  • Gene Description:
  • Werner helicase interacting protein 1
  • Gene Summary:
  • Werner's syndrome is a rare autosomal recessive disorder characterized by premature aging. The protein encoded by this gene interacts with the N-terminal portion of Werner protein containing the exonuclease domain. This protein shows homology to replication factor C family proteins, and is conserved from E. coli to human. Studies in yeast suggest that this gene may influence the aging process. Two transcript variants encoding different isoforms have been isolated for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000015944,OTTHUMP00000015945,Werner helicase interacting protein,putative helicase RUVBL
  • RSS
  • YouTube
  • Linkedin
  • Facebook