WRNIP1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with WRNIP1 polyclonal antibody (Cat # PAB22586) at 1:250-1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human testis with WRNIP1 polyclonal antibody (Cat # PAB22586) shows strong nuclear positivity in cells of seminiferus ducts at 1:10-1:20 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line U-251MG with WRNIP1 polyclonal antibody (Cat # PAB22586) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli and mitochondria.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant WRNIP1.
Immunogen
Recombinant protein corresponding to amino acids of human WRNIP1.
Sequence
YQGCHFIGMPECEVLLAQCVVYFARAPKSIEVYSAYNNVKARLRNHQGPLPPVPLHLRNAPTRLMKDLGYG
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with WRNIP1 polyclonal antibody (Cat # PAB22586) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human testis with WRNIP1 polyclonal antibody (Cat # PAB22586) shows strong nuclear positivity in cells of seminiferus ducts at 1:10-1:20 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-251MG with WRNIP1 polyclonal antibody (Cat # PAB22586) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli and mitochondria. -
Gene Info — WRNIP1
Entrez GeneID
56897Protein Accession#
Q96S55Gene Name
WRNIP1
Gene Alias
FLJ22526, RP11-420G6.2, WHIP, bA420G6.2
Gene Description
Werner helicase interacting protein 1
Omim ID
608196Gene Ontology
HyperlinkGene Summary
Werner's syndrome is a rare autosomal recessive disorder characterized by premature aging. The protein encoded by this gene interacts with the N-terminal portion of Werner protein containing the exonuclease domain. This protein shows homology to replication factor C family proteins, and is conserved from E. coli to human. Studies in yeast suggest that this gene may influence the aging process. Two transcript variants encoding different isoforms have been isolated for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000015944|OTTHUMP00000015945|Werner helicase interacting protein|putative helicase RUVBL
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com