OGT polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with OGT polyclonal antibody (Cat # PAB22483) at 1:250-1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human kidney with OGT polyclonal antibody (Cat # PAB22483) shows moderate cytoplasmic positivity in cells in tubules at 1:10-1:20 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with OGT polyclonal antibody (Cat # PAB22483) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant OGT.
Immunogen
Recombinant protein corresponding to amino acids of human OGT.
Sequence
NMFPHLKKKAVIDFKSNGHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCPDGGDNADSSNTALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATT
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with OGT polyclonal antibody (Cat # PAB22483) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human kidney with OGT polyclonal antibody (Cat # PAB22483) shows moderate cytoplasmic positivity in cells in tubules at 1:10-1:20 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with OGT polyclonal antibody (Cat # PAB22483) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli. -
Gene Info — OGT
Entrez GeneID
8473Protein Accession#
O15294Gene Name
OGT
Gene Alias
FLJ23071, HRNT1, MGC22921, O-GLCNAC
Gene Description
O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase)
Omim ID
300255Gene Ontology
HyperlinkGene Summary
O-linked N-acetylglucosamine (O-GlcNAc) transferase (OGT) catalyzes the addition of a single N-acetylglucosamine in O-glycosidic linkage to serine or threonine residues. Since both phosphorylation and glycosylation compete for similar serine or threonine residues, the two processes may compete for sites, or they may alter the substrate specificity of nearby sites by steric or electrostatic effects. The protein contains nine tetratricopeptide repeats and a putative bipartite nuclear localization signal. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq
Other Designations
O-GlcNAc transferase p110 subunit|O-linked GlcNAc transferase|OTTHUMP00000032154|OTTHUMP00000032166|uridinediphospho-N-acetylglucosamine:polypeptide beta-N-acetylglucosaminyl transferase
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com