Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TAF4B polyclonal antibody

  • Catalog # : PAB22229
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant TAF4B.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human TAF4B.
  • Sequence:
  • PHLVPFLKKSVVALRQLLPNSQSFIQQCVQQTSSDMVIATCTTTVTTSPVVTTTVSSSQSEKSIIVSGATAPRTVSVQTLNPLAGPVGAKAGVVTLHSVGPTAATGGTTAGTGLLQTSKPLVTSVANTVTTVSLQPEKPVVSGTAVT
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:50-1:200)
    Immunofluorescence (1-4 ug/mL)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human salivary gland with TAF4B polyclonal antibody (Cat # PAB22229) shows strong cytoplasmic positivity in subsets of glandular cells.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human cell line A-431 with TAF4B polyclonal antibody (Cat # PAB22229) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 6875
  • Gene Name:
  • TAF4B
  • Gene Alias:
  • TAF2C2,TAFII105
  • Gene Description:
  • TAF4b RNA polymerase II, TATA box binding protein (TBP)-associated factor, 105kDa
  • Gene Summary:
  • TATA-binding protein associated factors (TAFs) participate, with TATA binding protein (TBP; MIM 600075), in the formation of the TFIID protein complex (see MIM 313650), which is involved in the initiation of gene transcription by RNA polymerase II (see MIM 180660).[supplied by OMIM
  • Other Designations:
  • TATA box binding protein (TBP)-associated factor 4B,TATA box binding protein (TBP)-associated factor, RNA polymerase II, C2, 105kD,transcription initiation factor TFIID 105 kD subunit
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook