Product Browser

Last updated: 2016/9/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TRAPPC9 polyclonal antibody

  • Catalog # : PAB22125
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant TRAPPC9.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human TRAPPC9.
  • Sequence:
  • TVVPFQDHQNGVHNYDLHDTVSFVGSSTFYLDAVQPSGQSACLGALLFLYTGDFFLHIRFHEDSTSKELPPS
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:20-1:50)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human cerebellum with TRAPPC9 polyclonal antibody (Cat # PAB22125) shows distinct cytoplasmic positivity in Purkinje cells and nerve fibres.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Gene Name:
  • TRAPPC9
  • Gene Alias:
  • IBP,IKBKBBP,KIAA1882,MGC4737,MGC4769,NIBP,T1,TRS120
  • Gene Description:
  • trafficking protein particle complex 9
  • Gene Summary:
  • NIBP binds NIK (MIM 604655) and IKK-beta (IKBKB; MIM 603258) and plays a role in the neuronal NF-kappa-B (see MIM 164011) signaling pathway (Hu et al., 2005 [PubMed 15951441]).[supplied by OMIM
  • Other Designations:
  • IKK2 binding protein,NIK and IKK{beta} binding protein,TRAPP 120 kDa subunit,Tularik gene 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook