Product Browser

Last updated: 2016/9/25
  • Related Product Showcase
  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

VEZF1 polyclonal antibody

  • Catalog # : PAB22056
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant VEZF1.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human VEZF1.
  • Sequence:
  • RLWEEAVKARKKEAANLCQTSTAATTPVTLTTPFSITSSVSSGTMSNPVTVAAAMSMRSPVNVSSAVNITSPMNIGHPVTITSPLSMTSPLTLTTPVNLPTPVTAPVNIAHPVTITSPMNLPTPMTLAAPLNIAMRPVES
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:10-1:20)
    Immunofluorescence (1-4 ug/mL)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human nasopharynx with VEZF1 polyclonal antibody (Cat # PAB22056) shows moderate nuclear positivity in respiratory epithelial cells at 1:10-1:20 dilution.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human cell line U-251MG with VEZF1 polyclonal antibody (Cat # PAB22056) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 7716
  • Gene Name:
  • VEZF1
  • Gene Alias:
  • DB1,ZNF161
  • Gene Description:
  • vascular endothelial zinc finger 1
  • Gene Summary:
  • Transcriptional regulatory proteins containing tandemly repeated zinc finger domains are thought to be involved in both normal and abnormal cellular proliferation and differentiation. ZNF161 is a C2H2-type zinc finger protein (Koyano-Nakagawa et al., 1994 [PubMed 8035792]). See MIM 603971 for general information on zinc finger proteins.[supplied by OMIM
  • Other Designations:
  • zinc finger protein 161
  • RSS
  • YouTube
  • Linkedin
  • Facebook