HIVEP3 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human rectum with HIVEP3 polyclonal antibody (Cat # PAB21918) shows strong nuclear and cytoplasmic positivity in glandular cells.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant HIVEP3.
Immunogen
Recombinant protein corresponding to amino acids of human HIVEP3.
Sequence
SYSFDDHITDSEALSRSSHVFTSHPRMLKRQPAIELPLGGEYSSEEPGPSSKDTASKPSDEVEPKESELTKKTKKGLKTKGVIYECNICGARYKKRDNYEAHKKYYCSELQIAKPISAGTHTSPEAEKSQIEHEPWSQMMHYKLGTTL
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human rectum with HIVEP3 polyclonal antibody (Cat # PAB21918) shows strong nuclear and cytoplasmic positivity in glandular cells. -
Gene Info — HIVEP3
Entrez GeneID
59269Protein Accession#
Q5T1R4Gene Name
HIVEP3
Gene Alias
FLJ16752, KBP-1, KBP1, KIAA1555, KRC, SHN3, Schnurri-3, ZAS3, ZNF40C
Gene Description
human immunodeficiency virus type I enhancer binding protein 3
Omim ID
606649Gene Ontology
HyperlinkGene Summary
Members of the ZAS family, such as ZAS3 (HIVEP3), are large proteins that contain a ZAS domain, a modular protein structure consisting of a pair of C2H2 zinc fingers with an acidic-rich region and a serine/threonine -rich sequence. These proteins bind specific DNA sequences, including the kappa-B motif (GGGACTTTCC), in the promoters and enhancer regions of several genes and viruses, including human immunodeficiency virus (HIV). ZAS genes span more than 150 kb and contain at least 10 exons, one of which is longer than 5.5 kb (Allen and Wu, 2004).[supplied by OMIM
Other Designations
OTTHUMP00000007074|human immunodeficiency virus type I enhancer-binding protein 3|kappabinding protein-1
-
Interactome
-
Disease
-
Publication Reference
-
Combined overexpression of HIVEP3 and SOX9 predicts unfavorable biochemical recurrence-free survival in patients with prostate cancer.
Qin GQ, He HC, Han ZD, Liang YX, Yang SB, Huang YQ, Zhou L, Fu H, Li JX, Jiang FN, Zhong WD.
OncoTargets and Therapy 2014 Jan; 7:137.
Application：IHC-P, Human, Prostate cancer.
-
Combined overexpression of HIVEP3 and SOX9 predicts unfavorable biochemical recurrence-free survival in patients with prostate cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com