Product Browser

Last updated: 2016/9/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ARID4B polyclonal antibody

  • Catalog # : PAB21892
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant ARID4B.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human ARID4B.
  • Sequence:
  • DNNGKEESKIDHLTNNRNDLISKEEQNSSSLLEENKVHADLVISKPVSKSPERLRKDIEVLSEDTDYEEDEVTKKRKDVKKDTTDKSSKPQIKRGKR
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:50-1:200)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human placenta with ARID4B polyclonal antibody (Cat # PAB21892) shows moderate nuclear positivity in decidual cells at 1:50-1:200 dilution.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Gene Name:
  • ARID4B
  • Gene Alias:
  • BCAA,BRCAA1,DKFZp313M2420,MGC163290,RBBP1L1,RBP1L1,SAP180
  • Gene Description:
  • AT rich interactive domain 4B (RBP1-like)
  • Gene Summary:
  • This gene encodes a protein with sequence similarity to retinoblastoma-binding protein-1. The encoded protein is a subunit of the histone deacetylase-dependant SIN3A transcriptional corepressor complex, which functions in diverse cellular processes including proliferation, differentiation, apoptosis, oncogenesis, and cell fate determination. The gene product is recognized by IgG antibody isolated from a breast cancer patient and appears to be a molecular marker associated with a broad range of human malignancies. Alternate transcriptional splice variants encoding different isoforms have been characterized. [provided by RefSeq
  • Other Designations:
  • AT rich interactive domain 4B,OTTHUMP00000037596,RBP1-like protein,Rb-binding protein homolog,SIN3A-associated protein 180,breast cancer-associated antigen 1,breast carcinoma-associated antigen,retinoblastoma binding protein 1-like 1,retinoblastoma-bindin
  • RSS
  • YouTube
  • Linkedin
  • Facebook