Product Browser

Last updated: 2017/12/10

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FCER1G polyclonal antibody

  • Catalog # : PAB21846
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant FCER1G.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human FCER1G.
  • Sequence:
  • KIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:200-1:500)
    Western Blot (1:250-1:500)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot
  • Western Blot
  • Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with FCER1G polyclonal antibody (Cat # PAB21846).
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human bone marrow with FCER1G polyclonal antibody (Cat # PAB21846) shows strong cytoplasmic positivity in bone marrow poietic cells.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 2207
  • Gene Name:
  • FCER1G
  • Gene Alias:
  • FCRG
  • Gene Description:
  • Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide
  • Gene Summary:
  • The high affinity IgE receptor is a key molecule involved in allergic reactions. It is a tetramer composed of 1 alpha, 1 beta, and 2 gamma chains. The gamma chains are also subunits of other Fc receptors. [provided by RefSeq
  • Other Designations:
  • Fc fragment of IgE, high affinity I, receptor for, gamma polypeptide,OTTHUMP00000032239,OTTHUMP00000063478,immunoglobulin E receptor, high affinity, gamma chain
  • RSS
  • YouTube
  • Linkedin
  • Facebook