Product Browser

Last updated: 2016/9/25
  • Related Product Showcase
  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RAB3GAP2 polyclonal antibody

  • Catalog # : PAB21794
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant RAB3GAP2.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human RAB3GAP2.
  • Sequence:
  • TYEIPRHPGVTEQNEELSILYPAAIVTIDGFSLFQSLRACRNQVAKAAASGNENIQPPPLAYKKWGLQDIDTIIDHASVGIMTLSPFDQMKTA
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:50-1:200)
    Immunofluorescence (1-4 ug/mL)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human bronchus with RAB3GAP2 polyclonal antibody (Cat # PAB21794) shows strong cytoplasmic positivity in respiratory epithelial cells.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human cell line U-251 MG with RAB3GAP2 polyclonal antibody (Cat # PAB21794) at 1-4 ug/mL dilution shows positivity in cytoplasm.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Gene Name:
  • RAB3GAP2
  • Gene Alias:
  • DKFZp434D245,FLJ14579,KIAA0839,RAB3-GAP150,RAB3GAP150,p150
  • Gene Description:
  • RAB3 GTPase activating protein subunit 2 (non-catalytic)
  • Gene Summary:
  • Members of the RAB3 protein family (see RAB3A; MIM 179490) are implicated in Ca(2+)-dependent exocytosis. RAB3GAP, which is involved in regulation of RAB3 activity, is a heterodimeric complex consisting a 130-kD catalytic subunit (RAB3GAP1; MIM 602536) and a 150-kD noncatalytic subunit (RAB3GAP2) (Nagano et al., 1998 [PubMed 9733780]).[supplied by OMIM
  • Other Designations:
  • rab3 GTPase-activating protein, non-catalytic subunit,rab3 GTPase-activating protein, non-catalytic subunit (150kD),rab3 GTPase-activating protein, non-catalytic subunit (RAB3-GAP150)
  • RSS
  • YouTube
  • Linkedin
  • Facebook