C17orf70 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with C17orf70 polyclonal antibody (Cat # PAB21630) at 1:250-1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human kidney with C17orf70 polyclonal antibody (Cat # PAB21630) shows strong cytoplasmic positivity in proximal tubules at 1:50-1:200 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line U-251MG with C17orf70 polyclonal antibody (Cat # PAB21630) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant C17orf70.
Immunogen
Recombinant protein corresponding to amino acids of human C17orf70.
Sequence
VPLCCATLQWLLAENAAVDVVRARALSSIQGVAPDGANVHLIVREVAMTDLCPAGPIQAVEIQVESSSLA
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with C17orf70 polyclonal antibody (Cat # PAB21630) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human kidney with C17orf70 polyclonal antibody (Cat # PAB21630) shows strong cytoplasmic positivity in proximal tubules at 1:50-1:200 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-251MG with C17orf70 polyclonal antibody (Cat # PAB21630) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli. -
Gene Info — C17orf70
Entrez GeneID
80233Protein Accession#
Q0VG06Gene Name
C17orf70
Gene Alias
FAAP100, FLJ22175, FLJ30151
Gene Description
chromosome 17 open reading frame 70
Omim ID
611301Gene Ontology
HyperlinkGene Summary
FAAP100 is a component of the Fanconi anemia (FA; MIM 277650) core complex and is required for core complex stability and FANCD2 (see MIM 227646) monoubiquitination (Ling et al., 2007 [PubMed 17396147]).[supplied by OMIM
Other Designations
Fanconi anemia associated protein 100 kDa subunit|Fanconi anemia core complex 100 kDa subunit
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com