BICD2 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with BICD2 polyclonal antibody (Cat # PAB21522) at 1:250-1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human esophagus with BICD2 polyclonal antibody (Cat # PAB21522) shows strong cytoplasmic positivity in squamous epithelial cells at 1:200-1:500 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with BICD2 polyclonal antibody (Cat # PAB21522) at 1-4 ug/mL dilution shows positivity in plasma membrane and cytoplasm.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant BICD2.
Immunogen
Recombinant protein corresponding to amino acids of human BICD2.
Sequence
MSAPSEEEEYARLVMEAQPEWLRAEVKRLSHELAETTREKIQAAEYGLAVLEEKHQLKLQFEELEVDYEAI
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with BICD2 polyclonal antibody (Cat # PAB21522) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human esophagus with BICD2 polyclonal antibody (Cat # PAB21522) shows strong cytoplasmic positivity in squamous epithelial cells at 1:200-1:500 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with BICD2 polyclonal antibody (Cat # PAB21522) at 1-4 ug/mL dilution shows positivity in plasma membrane and cytoplasm. -
Gene Info — BICD2
Entrez GeneID
23299Protein Accession#
Q8TD16Gene Name
BICD2
Gene Alias
KIAA0699, bA526D8.1
Gene Description
bicaudal D homolog 2 (Drosophila)
Omim ID
609797Gene Ontology
HyperlinkGene Summary
This gene is one of two human homologs of Drosophila bicaudal-D and a member of the Bicoid family. It has been implicated in dynein-mediated, minus end-directed motility along microtubules. It has also been reported to be a phosphorylation target of NIMA related kinase 8. Two alternative splice variants have been described. [provided by RefSeq
Other Designations
OTTHUMP00000022790|OTTHUMP00000022791|bicaudal D homolog 2|coiled-coil protein BICD2|cytoskeleton-like bicaudal D protein homolog 2|homolog of Drosophila bicaudal D
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com