Product Browser

Last updated: 2016/9/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NIPA1 polyclonal antibody

  • Catalog # : PAB21503
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant NIPA1.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human NIPA1.
  • Sequence:
  • HGPTNIMVYISICSLLGSFTVPSTKGIGLAAQDILHNNPSSQRA
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:10-1:20)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human urinary bladder with NIPA1 polyclonal antibody (Cat # PAB21503) shows strong membranous positivity in urothelial cells at 1:10-1:20 dilution.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Gene Name:
  • NIPA1
  • Gene Alias:
  • FSP3,MGC102724,MGC35570,SPG6
  • Gene Description:
  • non imprinted in Prader-Willi/Angelman syndrome 1
  • Gene Summary:
  • This gene encodes a magnesium transporter that associates with early endosomes and the cell surface in a variety of neuronal and epithelial cells. This protein may play a role in nervous system development and maintenance. Multiple transcript variants encoding different isoforms have been found for this gene. Mutations in this gene have been associated with autosomal dominant spastic paraplegia 6. [provided by RefSeq
  • Other Designations:
  • non-imprinted in Prader-Willi/Angelman syndrome 1,spastic paraplegia 6 (autosomal dominant)
  • RSS
  • YouTube
  • Linkedin
  • Facebook