Product Browser

Last updated: 2017/2/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BLOC1S1 polyclonal antibody

  • Catalog # : PAB21399
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant BLOC1S1.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human BLOC1S1.
  • Sequence:
  • LLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQ
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:20-1:50)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human small intestine with BLOC1S1 polyclonal antibody (Cat # PAB21399) strong cytoplasmic positivity in glandular cells at 1:20-1:50 dilution.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 2647
  • Gene Name:
  • BLOC1S1
  • Gene Alias:
  • BLOS1,FLJ39337,FLJ97089,GCN5L1,MGC87455,MICoA,RT14
  • Gene Description:
  • biogenesis of lysosomal organelles complex-1, subunit 1
  • Gene Summary:
  • BLOC1S1 is a component of the ubiquitously expressed BLOC1 multisubunit protein complex. BLOC1 is required for normal biogenesis of specialized organelles of the endosomal-lysosomal system, such as melanosomes and platelet dense granules (Starcevic and Dell'Angelica, 2004 [PubMed 15102850]).[supplied by OMIM
  • Other Designations:
  • BLOC subunit 1,BLOC-1 subunit 1,GCN5 (general control of amino-acid synthesis, yeast, homolog)-like 1,GCN5 general control of amino-acid synthesis 5-like 1,MTA1-interacting coactivator,biogenesis of lysosome-related organelles complex-1, subunit 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook