Product Browser

Last updated: 2016/9/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GTPBP10 polyclonal antibody

  • Catalog # : PAB21354
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant GTPBP10.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human GTPBP10.
  • Sequence:
  • ALKGSKGKDCEIPVPVGISVTDENGKIIGELNKENDRILVAQGGLGGKLLTNFLPLKGQKRIIHLDLKLIADVGLVGFPNAGKSSLLSCVSHAKPAIADYAF
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:50-1:200)
    Western Blot (1:250-1:500)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot
  • Western Blot
  • Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: human plasma, Lane 4: liver, Lane 5: tonsil GTPBP10 polyclonal antibody (Cat # PAB21354).
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human duodenum with GTPBP10 polyclonal antibody (Cat # PAB21354) shows strong nuclear and cytoplasmic positivity in glandular cells.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Gene Name:
  • GTPBP10
  • Gene Alias:
  • DKFZp686A10121,FLJ38242,MGC104191,ObgH2,UG0751c10
  • Gene Description:
  • GTP-binding protein 10 (putative)
  • Gene Summary:
  • Small G proteins, such as GTPBP10, act as molecular switches that play crucial roles in the regulation of fundamental cellular processes such as protein synthesis, nuclear transport, membrane trafficking, and signal transduction (Hirano et al., 2006 [PubMed 17054726]).[supplied by OMIM
  • Other Designations:
  • GTP-binding protein 10
  • RSS
  • YouTube
  • Linkedin
  • Facebook