NSUN5 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with NSUN5 polyclonal antibody (Cat # PAB21311) at 1:250-1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human rectum with NSUN5 polyclonal antibody (Cat # PAB21311) shows strong nuclear and cytoplasmic positivity in glandular cells at 1:200-1:500 dilution.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant NSUN5.
Immunogen
Recombinant protein corresponding to amino acids of human NSUN5.
Sequence
QLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPLYRAGHLIL
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with NSUN5 polyclonal antibody (Cat # PAB21311) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human rectum with NSUN5 polyclonal antibody (Cat # PAB21311) shows strong nuclear and cytoplasmic positivity in glandular cells at 1:200-1:500 dilution. -
Gene Info — NSUN5
Entrez GeneID
55695Protein Accession#
Q96P11Gene Name
NSUN5
Gene Alias
FLJ10267, MGC986, NOL1, NOL1R, NSUN5A, WBSCR20, WBSCR20A, Ynl022cL, p120
Gene Description
NOL1/NOP2/Sun domain family, member 5
Gene Ontology
HyperlinkGene Summary
This gene encodes a protein with similarity to p120 (NOL1), a 120-kDa proliferation-associated nucleolar antigen that is a member of an evolutionarily conserved protein family. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
NOL1/NOP2/sun gene family member|Williams Beuren syndrome chromosome region 20A|Williams-Beuren syndrome critical region protein 20 copy A
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com