WIPI2 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with WIPI2 polyclonal antibody (Cat # PAB21251) at 1:250-1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human skeletal muscle with WIPI2 polyclonal antibody (Cat # PAB21251) shows strong cytoplasmic positivity in selected fibers at 1:50-1:200 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line A-431 with WIPI2 polyclonal antibody (Cat # PAB21251) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli and cytoplasm.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant WIPI2.
Immunogen
Recombinant protein corresponding to amino acids of human WIPI2.
Sequence
ECALMKQHRLDGSLETTNEILDSASHDCPLVTQTYGAAAGKGTYVPSSPTRLAYTDDLGAVGGACLEDEASALRLDEDSEHPPMILRTD
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with WIPI2 polyclonal antibody (Cat # PAB21251) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human skeletal muscle with WIPI2 polyclonal antibody (Cat # PAB21251) shows strong cytoplasmic positivity in selected fibers at 1:50-1:200 dilution.Immunofluorescence
Immunofluorescent staining of human cell line A-431 with WIPI2 polyclonal antibody (Cat # PAB21251) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli and cytoplasm. -
Gene Info — WIPI2
Entrez GeneID
26100Protein Accession#
Q9Y4P8Gene Name
WIPI2
Gene Alias
Atg21, CGI-50, DKFZp434J154, DKFZp686P02188, FLJ12979, FLJ14217, FLJ42984, WIPI-2
Gene Description
WD repeat domain, phosphoinositide interacting 2
Omim ID
609225Gene Ontology
HyperlinkGene Summary
WD40 repeat proteins are key components of many essential biologic functions. They regulate the assembly of multiprotein complexes by presenting a beta-propeller platform for simultaneous and reversible protein-protein interactions. Members of the WIPI subfamily of WD40 repeat proteins, such as WIPI2, have a 7-bladed propeller structure and contain a conserved motif for interaction with phospholipids (Proikas-Cezanne et al., 2004 [PubMed 15602573]).[supplied by OMIM
Other Designations
WD40 repeat protein interacting with phosphoinositides 2|WIPI49-like protein 2
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com